PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015866776.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family SRS
Protein Properties Length: 382aa    MW: 39516.6 Da    PI: 9.1912
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015866776.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702131.68.3e-412563582104
          DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaes 96 
                     +sgt++CqdCGnqakkdC+h+RCRtCCksrgfdCathvkstWvpaa+rrerq +   a++ a +sa+++ +k++r  +s++++++s+t++s++++
  XP_015866776.1 256 SSGTTTCQDCGNQAKKDCSHRRCRTCCKSRGFDCATHVKSTWVPAARRRERQLMSGVAAAAAGSSASTSGAKKPRLVTSQQTTTTSHTSTSNTTP 350
                     57899****************************************************************************************** PP

          DUF702  97 kkeletss 104
                     +++++tss
  XP_015866776.1 351 PRSFDTSS 358
                     ***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051428.5E-34259350IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016237.8E-27261303IPR006510Zinc finger, lateral root primordium type 1
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
YWIGLDLIKK GKSSELVVAT TRRLPSDSGA FADWVASSSS AAAAARPPPT VPDDLSLGFN  60
AGPTAAAAGA TSSSMWPLGG PSSSSSRPIN YGLPPEMGMV GLRDVFVVAP ASSFHPHNNH  120
HHHHHLHHHH EPLLSSSSDH PHSINVSSNP ATALGVGVGV GVIPLLTASP CLATAPPPNL  180
AGSIDDDSSN ALAARSRSGG IQLWQQQNQQ QQTQQHFFKK PAILDHGGNS GGGAAHLVQN  240
SDGSGGLGGS GGGGSSSGTT TCQDCGNQAK KDCSHRRCRT CCKSRGFDCA THVKSTWVPA  300
ARRRERQLMS GVAAAAAGSS ASTSGAKKPR LVTSQQTTTT SHTSTSNTTP PRSFDTSSSH  360
QGFLFFHFSS TSSSSSLYFV FI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015866776.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1, partial
TrEMBLA0A118K4X71e-89A0A118K4X7_CYNCS; Lateral Root Primordium type 1, C-terminal
STRINGVIT_06s0009g03450.t012e-74(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.31e-29Lateral root primordium (LRP) protein-related